.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ne7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Paia N-Acetyltransferase from Thermoplasma Acidophilum in Complex with Coenzyme A. To be Published
    Site MCSG
    PDB Id 3ne7 Target Id APC61169.1
    Related PDB Ids 3k9u 3fix 3f0a 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS24479,CAC11518.1, 3.40.630.30, 2303 Molecular Weight 18779.83 Da.
    Residues 159 Isoelectric Point 7.73
    Sequence msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsnldilflgaf adstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgilecrlyvhrqnsvgfsfy ykngfkvedtdgsdfimekky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 2.86 Rfactor 0.184
    Waters 48 Solvent Content 57.06

    Ligand Information
    Ligands COA-BME (COENZYME) x 1;BME (BETA-MERCAPTOETHANOL) x 1;SO4 (BETA-MERCAPTOETHANOL) x 1;GOL (SULFATE) x 1;UNL (GLYCEROL) x 1
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 3ne7
    1. Crystal structure of the novel PaiA N_acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme
    EV Filippova, L Shuvalova, G Minasov - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. A Novel N-Acetylglutamate Synthase Architecture Revealed by the Crystal Structure of the Bifunctional Enzyme from Maricaulis maris
    D Shi, Y Li, J Cabrera-Luque, Z Jin, X Yu, G Zhao - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch