.
The Open Protein Structure Annotation Network
PDB Keyword
.

3neu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally-unknown protein lin1836 from Listeria innocua Clip11262. To be Published
    Site MCSG
    PDB Id 3neu Target Id APC88792
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS48684,NP_471171.1, PF00392.11, 272626 Molecular Weight 13965.23 Da.
    Residues 122 Isoelectric Point 6.75
    Sequence mnptfhadkpiysqisdwmkkqmitgewkgedklpsvremgvklavnpntvsrayqeleragyiyakrg mgsfvtsdkalfdqlkkeladaiterfleeaksiglddqtaiellikrsrnhe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.2219
    Matthews' coefficent 2.44 Rfactor 0.1936
    Waters 98 Solvent Content 49.50

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3neu
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch