.
The Open Protein Structure Annotation Network
PDB Keyword
.

3njf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SO1698 protein from Shewanella oneidensis, a novel autocatalytic aspartic peptidase. to be published
    Site MCSG
    PDB Id 3njf Target Id APC83618
    Related PDB Ids 3nji 3n55 3njg 3njh 3njl 3njm 3njn 3njj 3njk 
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5699,NP_717309, 211586 Molecular Weight 13447.71 Da.
    Residues 125 Isoelectric Point 4.23
    Sequence mfapqglaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvgvgfvtpf dgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspdpqiinrpqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.47 Rfree 0.2671
    Matthews' coefficent 3.55 Rfactor 0.2211
    Waters 70 Solvent Content 65.30

    Ligand Information
    Ligands PRO-GLN-ILE-ILE-ASN-ARG-PRO x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch