.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nkg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of GEBA250068378 from Sulfurospirillum deleyianum. To be Published 2010
    Site MCSG
    PDB Id 3nkg Target Id APC37425.1
    Molecular Characteristics
    Source 525898
    Alias Ids TPS48580,LNXCP0ADSZSQUI7ZJLDALZTWVLM, 525898 Molecular Weight 19611.16 Da.
    Residues 172 Isoelectric Point 5.66
    Sequence npnpisipidlsqagsvvekevkieeswsyhlilqfavhdrkedggldgkrvwkflgfnsydprdgkqv gyvdyrlakselgdlidetydcdgtvvpikitihqinqdntkkliadnlymtkgngsgaytrdittisl dkgkyifrienieafsemigrkvdftiyinkrdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.214
    Matthews' coefficent 2.33 Rfactor 0.169
    Waters 294 Solvent Content 47.24

    Ligand Information
    Ligands ACY (ACETIC) x 5;GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3nkg
    1. Metagenomics and the protein universe
    A Godzik - Current opinion in structural biology, 2011 - Elsevier
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch