.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nrv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal strucutre of MarR/EmrR family transcriptional regulator from Acinetobacter sp. ADP1. To be Published
    Site MCSG
    PDB Id 3nrv Target Id APC88533
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS48682,YP_046468.1, PF01047.13, 62977 Molecular Weight 16646.32 Da.
    Residues 145 Isoelectric Point 6.17
    Sequence mqkinidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqkisdilgldkaavs rtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierekqlleefeeaekdqlfillkkl rnkvdqm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2295
    Matthews' coefficent 3.08 Rfactor 0.1957
    Waters 302 Solvent Content 60.02

    Ligand Information
    Ligands SO4 (SULFATE) x 7;GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3nrv
    1. Near-Native Protein Loop Sampling Using Nonparametric Density Estimation Accommodating Sparcity
    H Joo, AG Chavan, R Day, KP Lennox - PLoS computational , 2011 - dx.plos.org
     
    2. Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal
    JY Zhu, ZQ Fu, L Chen, H Xu, J Chrzas - Section D: Biological , 2012 - scripts.iucr.org
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch