.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nuw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae (CASP Target). To be Published
    Site MCSG
    PDB Id 3nuw Target Id APC38818
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS48595,ABR79480.1, PF05035.2.HMM.1, 272620 Molecular Weight 31137.70 Da.
    Residues 292 Isoelectric Point 5.97
    Sequence mtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdgatpvvmagmvgs nvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmrgeetqllgaralapssvyvmp gthckwvladrrqihdfrtvltgelhhlllqlslvgaglppqetsaaafaaglqrginnpavlpqlfev rashvlgalpreqvseflsglligaevatlsdtfagqqaislvagssltsryqqafaaigrevsavagd tafqtgirsiayavan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.201
    Matthews' coefficent 3.16 Rfactor 0.173
    Waters 539 Solvent Content 61.12

    Ligand Information
    Ligands FMT (FORMIC) x 3;GOL (GLYCEROL) x 18
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch