.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nyi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a fat acid (stearic acid)-binding protein from Eubacterium ventriosum ATCC 27560. TO BE PUBLISHED
    Site MCSG
    PDB Id 3nyi Target Id APC21054
    Molecular Characteristics
    Source Eubacterium ventriosum atcc 27560
    Alias Ids TPS48560,CFBIC5HHCRPSO8CVZL3CI9T0LY4, 411463 Molecular Weight 32386.28 Da.
    Residues 293 Isoelectric Point 4.92
    Sequence mykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpklfpktslpsves yadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanicvidskqntvtqallidqfvrm ledglsfeqamskldalmasarifftvgsldylkmggrigkvataatgklgvkpviimkdgdiglggig rnrnklknsvlqvakkyldennkdnfivsvgygydkeegfefmkevestldvkldsetnvaigivsavh tgpypiglgvirkyetl
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.2203
    Matthews' coefficent 2.54 Rfactor 0.1682
    Waters Solvent Content 51.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nyi
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch