.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nym

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of functionally unknown protein from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 3nym Target Id APC83772
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS48660,AAF40932.1, 122586 Molecular Weight 14437.54 Da.
    Residues 125 Isoelectric Point 4.50
    Sequence metlndikkilinvglyqgfdltdpkvseevnhetanmkwikdytsdgnwdnefkedlknfldymevcq lalndknfkiasnslfmamiyagnlslifdsiktdistllsaeykknsfswpslde
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.2082
    Matthews' coefficent 2.61 Rfactor 0.1726
    Waters Solvent Content 52.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nym
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch