.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein from Saccharomyces cerevisiae. TO BE PUBLISHED
    Site MCSG
    PDB Id 3o12 Target Id APC7838
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS48559,NP_012318.1, 4932 Molecular Weight 21965.63 Da.
    Residues 198 Isoelectric Point 5.95
    Sequence mveskntelsqgtwlnkpksvfqeagkvtletdektdfwretfygftrdsghflgvetgsaftaqvrvq gsyeslydqagimvriddghwlkagieisdghamlssvltngksdwstavyggnardfwlrvtvekgvl riqvssdkktwplvrlapfptsdhylvgpmactpergglkvtfsewsltaplgkalhdls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.1853
    Matthews' coefficent 2.28 Rfactor 0.1668
    Waters 178 Solvent Content 46.12

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3o12
    1. Eukaryote-wide sequence analysis of mitochondrial _-barrel outer membrane proteins
    K Imai, N Fujita, MM Gromiha, P Horton - BMC genomics, 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch