.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o5v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A. To be Published
    Site MCSG
    PDB Id 3o5v Target Id APC63996.2
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS48635,AAK33512.1, 3.40.350.10, 160490 Molecular Weight 14712.09 Da.
    Residues 129 Isoelectric Point 5.73
    Sequence kldqirlyldqkgaelaifsdpvtinyltgffcdpherqlflfvyhdlapvlfvpalevarasqaisfp vfgyvdsenpwekikavlpntaaktiyaefdhlnvnkfhglqtifsgqfnnltpyvqgmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.224
    Matthews' coefficent 2.75 Rfactor 0.192
    Waters 169 Solvent Content 55.30

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch