.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the GAF domain of a two-component sensor histidine kinase from Bacillus halodurans to 2.45A. To be Published
    Site MCSG
    PDB Id 3o5y Target Id APC67311.1
    Molecular Characteristics
    Source Bacillus halodurans c
    Alias Ids TPS48651,BAB04255, 272558 Molecular Weight 18771.50 Da.
    Residues 162 Isoelectric Point 5.34
    Sequence mslddiinnmidklkllvhfdrisflllanetlklshvypkgshsldigstipkeqslywsaldqrqti frsltdtqdnfyekqylaildlksilvipiysknkrvgvlsigrkqqidwslddlafleqltdhlavsi envelygqvlrskqewedtfkavd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.269
    Matthews' coefficent 3.28 Rfactor 0.221
    Waters 22 Solvent Content 62.50

    Ligand Information
    Ligands ACT (ACETATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch