The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    PDB Id 3o60 Target Id APC39014.0
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS48598,CAC96093, 1642 Molecular Weight 22011.42 Da.
    Residues 185 Isoelectric Point 8.52
    Sequence mnnyvkvhqplnvdlrtqktqtklytvlerfyvedrtfesisikdlceqarvsratfyrhhkeiiqvie vqilrtmqyfslefdqiiltkeniqrlilrtiqknpllfqvifwsraenifidvvsgeilrisllkevs fsdskfmpncfarmilslaaeiqqsnkdytndqlveliqeaarflqk
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information


    Google Scholar output for 3o60
    1. Hsp90 inhibitors and drugs from fragment and virtual screening
    S Roughley, L Wright, P Brough, A Massey, R Hubbard - [Without Title], 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch