The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302. To be Published
    Site MCSG
    PDB Id 3obf Target Id APC67171.1
    Molecular Characteristics
    Source Arthrobacter aurescens tc1
    Alias Ids TPS48649,ABM09629, 290340 Molecular Weight 19049.46 Da.
    Residues 174 Isoelectric Point 5.63
    Sequence eerrvaypvlreltertgetsalmvwngnesmcveqipsrhqvkhlaplgarynealsssvqvflasen edrvrqllrsgsitltgvdedaveayllrlkesmergwavnfgetsieevgvaspvydhrgnmvasvli papkfrvsqdtlnslgeacaaaaakvttrlggraph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.16 Rfree 0.2236
    Matthews' coefficent 2.01 Rfactor 0.1737
    Waters 117 Solvent Content 38.91

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch