.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oco

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    PDB Id 3oco Target Id APC63490.1
    Molecular Characteristics
    Source Oenococcus oeni psu
    Alias Ids TPS48629,ABJ56131.1, 3.20.20.70, 203123 Molecular Weight 17147.14 Da.
    Residues 150 Isoelectric Point 4.11
    Sequence deedanfmqrafemndkvasdvmvdrtsmsvvdvdetiadalllyleeqysrfpvtadndkdkiigyay nydivrqariddkakistimrdivsvpenmkvpdvmeemsahrvpmaivideyggtsgiitdkdvyeel fgnlrdeqdded
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3oco
    1. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    2. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch