.
The Open Protein Structure Annotation Network
PDB Keyword
.

3od1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of aATP phosphoribosyltransferase regulatory subunit/histidyl-tRNA synthetase from Bacillus halodurans C. To be Published
    Site MCSG
    PDB Id 3od1 Target Id APC38906
    Molecular Characteristics
    Source Bacillus halodurans c
    Alias Ids TPS48596,BAB07303.1, 3.30.930.10, 272558 Molecular Weight 44251.20 Da.
    Residues 397 Isoelectric Point 5.41
    Sequence mskpfmfekpfgmrdtlpewyktkknicdqmteeinlwgydmietptleyyetvgvvsaildqqlfkll dqqgntlvlrpdmtapiarlvasslkdrayplrlayqsnvyraqqneggkpaefeqlgveligdgtasa dgevialmiaalkraglsefkvaighvgyvnallmdvvgneqradrlrrflyeknyvgyrehvkslnls tidksrlmnllslrggraaieeargliqtekgktalaemtklyevlesygaseyvkfdltlvlhmsyyt gvvfegygnrlgvplcsggrydellskfhrpaqatgfgvridllvealngeiisngheqtcilfsnerr feaielarkkrangeavvlqdlagvtdvdamssnyqdviycigtagrggeda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.2242
    Matthews' coefficent 2.64 Rfactor 0.1792
    Waters 343 Solvent Content 53.39

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2;BME (BETA-MERCAPTOETHANOL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch