.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ogh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of yciE protein from E. coli CFT073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins. To be Published
    Site MCSG
    PDB Id 3ogh Target Id APC38261
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS48592,AAN80190.1, PF05974.2.HMM.1, 199310 Molecular Weight 18992.46 Da.
    Residues 168 Isoelectric Point 5.13
    Sequence mnriehyhdwlrdahamekqaesmlesmasridnypelrarieqhlsetknqivqletildrndisrsv ikdsmskmaalgqsiggifpsdeivkgsisgyvfeqfeiacytsllaaaknagdtasiptieailneek hmadwliqhipqttekflirsetdgveakk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.21291
    Matthews' coefficent 1.96 Rfactor 0.16648
    Waters 196 Solvent Content 37.27

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;FE (FE) x 2;MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch