.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oi8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of functionally unknown conserved protein domain from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 3oi8 Target Id APC83979.5
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS48671,AAF40966.1, 3.20.20.70, 122586 Molecular Weight 17557.09 Da.
    Residues 153 Isoelectric Point 4.89
    Sequence saedvlnllrqaheqevfdadtllrlekvldfsdlevrdamitrsrmnvlkendsieritayvidtahs rfpvigedkdevlgilhakdllkymfnpeqfhlksilrpavfvpegksltallkefreqrnhmaivide yggtsglvtfediie
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.2320
    Matthews' coefficent 2.29 Rfactor 0.1823
    Waters Solvent Content 46.28

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch