.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oiz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of antisigma-factor antagonist, STAS domain from Rhodobacter sphaeroides. To be Published
    Site MCSG
    PDB Id 3oiz Target Id APC63694.3
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS48630,ABA81648.1, 3.30.750.24, 272943 Molecular Weight 10967.86 Da.
    Residues 96 Isoelectric Point 4.85
    Sequence lfgvtselskdgreriyrvegqlfyasvedfmaafdfrealdrvvidvsrahiwdissvqaldmavlkf rregaevrivgmneasetmvdrlaihd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2156
    Matthews' coefficent 2.07 Rfactor 0.1597
    Waters 110 Solvent Content 40.55

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch