.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oj0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamyl-tRNA reductase from Thermoplasma volcanium (nucleotide binding domain). To be Published
    Site MCSG
    PDB Id 3oj0 Target Id APC64114.2
    Molecular Characteristics
    Source Thermoplasma volcanium gss1
    Alias Ids TPS48636,BAB59732.1, 3.40.50.720, 273116 Molecular Weight 15904.39 Da.
    Residues 141 Isoelectric Point 5.49
    Sequence gkvsipsivydivrknggnkillvgngmlaseiapyfsypqykvtvagrnidhvrafaekyeyeyvlin didsliknndviitatssktpiveerslmpgklfidlgnppniergnnvitldeiyeiskknemlreek inq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.1833
    Matthews' coefficent 2.53 Rfactor 0.1596
    Waters 84 Solvent Content 51.41

    Ligand Information
    Ligands GOL (GLYCEROL) x 6;SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch