.
The Open Protein Structure Annotation Network
PDB Keyword
.

3olo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PAS domain from two-component sensor histidine kinase. To be Published
    Site MCSG
    PDB Id 3olo Target Id APC67115.3
    Molecular Characteristics
    Source 103690
    Alias Ids TPS48648,BAB72386, 103690 Molecular Weight 13903.96 Da.
    Residues 115 Isoelectric Point 4.99
    Sequence mniqselefkfahylinnaveasfclgdnwqflyvndatcrmteysreqllsmnlqdidvdfalhdwee irqknnytfktryrsqsgriflvemsltfledqerrfscvfvreks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.2268
    Matthews' coefficent 2.15 Rfactor 0.1772
    Waters 53 Solvent Content 42.84

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch