.
The Open Protein Structure Annotation Network
PDB Keyword
.

3olq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a universal stress protein E from Proteus mirabilis HI4320. To be Published
    Site MCSG
    PDB Id 3olq Target Id APC67700.0
    Molecular Characteristics
    Source Proteus mirabilis hi4320
    Alias Ids TPS48656,CAR42558, 529507 Molecular Weight 35952.49 Da.
    Residues 316 Isoelectric Point 5.42
    Sequence mekyqnllvvidpnqddqpalrravyivqrnggrikaflpvydlsydmttllspdernamrkgvinqkt awikqqaryyleagiqidikviwhnrpyeaiieevitdkhdllikmahqhdklgsliftpldwqllrkc papvwmvkdkewpeygtivvaanlsneesyhdalnlklieltndlshriqkdpdvhllsaypvapinia ielpdfdpnlynnalrgqhliamkelrqkfsipeekthvkeglpeqvipqvceelnagivvlgilgrtg lsaaflgntaeqlidhikcdllaikpdgftcpitvdsdne
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.1961
    Matthews' coefficent 3.00 Rfactor 0.1712
    Waters Solvent Content 59.01

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch