.
The Open Protein Structure Annotation Network
PDB Keyword
.

3om8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3om8 Target Id APC37789.1
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS48582,NP_249171.1, 208964 Molecular Weight 28084.45 Da.
    Residues 263 Isoelectric Point 5.90
    Sequence gnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlrydarghgassvppg pytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierlvlantsawlgpaaqwderia avlqaedmsetaagflgnwfppalleraepvverframlmatnrhglagsfaavrdtdlraqlarierp tlviagaydtvtaashgeliaasiagarlvtlpavhlsnvefpqafegavlsflga
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.2228
    Matthews' coefficent 5.20 Rfactor 0.1922
    Waters Solvent Content 76.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch