.
The Open Protein Structure Annotation Network
PDB Keyword
.

3omd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein from Leptospirillum rubarum. To be Published
    Site MCSG
    PDB Id 3omd Target Id APC41476.0
    Molecular Characteristics
    Source Leptospirillum sp. group ii uba
    Alias Ids TPS48610,EAY57636, 419542 Molecular Weight 16274.42 Da.
    Residues 140 Isoelectric Point 6.42
    Sequence mdltkqfprspvdrlggmdhlkrvidkarahvagtlgeytyncpldqaffsffgldhekfaeavksrpq dqdmlawvhsqsprsknpkevesfnreyesrspdspekwdyfrsvrdslapgrtdittwvklldleekr pv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.1864
    Matthews' coefficent 2.49 Rfactor 0.1510
    Waters 346 Solvent Content 50.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3omd
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch