.
The Open Protein Structure Annotation Network
PDB Keyword
.

3on1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a protein with unknown function from Bacillus halodurans C. To be Published
    Site MCSG
    PDB Id 3on1 Target Id APC41278.0
    Molecular Characteristics
    Source Bacillus halodurans c
    Alias Ids TPS48607,BAB06133, 272558 Molecular Weight 10920.30 Da.
    Residues 101 Isoelectric Point 9.93
    Sequence mseakwlsllglaararqlltgeeqvvkavqngqvtlvilssdagihtkkklldkcgsyqipvkvvgnr qmlgraigkhervvigvkdagfsrklaalide
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.20271
    Matthews' coefficent 2.08 Rfactor 0.18356
    Waters Solvent Content 40.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3on1
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch