.
The Open Protein Structure Annotation Network
PDB Keyword
.

3on2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a protein with unknown function from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 3on2 Target Id APC5887
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4901,RHA02676, 101510 Molecular Weight 20827.30 Da.
    Residues 199 Isoelectric Point 5.97
    Sequence mpvaeqpyhhgslrrvllaraestlekdgvdglslrqlareagvshaapskhfrdrqalldalaesgfl rltaaleraveeaeshararfaalagayvsfalahrellalmygnkhapgaasqvveaghasmdltvri vteaqaagdigpgdasrialvafatfhgiatlaaggmldgapvdevvtaasdtfwrglaqa
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.22157
    Matthews' coefficent 2.24 Rfactor 0.16759
    Waters Solvent Content 45.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch