.
The Open Protein Structure Annotation Network
PDB Keyword
.

3onq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Regulator of Polyketide Synthase Expression BAD_0249 from Bifidobacterium adolescentis. To be Published
    Site MCSG
    PDB Id 3onq Target Id APC38930
    Molecular Characteristics
    Source Bifidobacterium adolescentis atcc 15703
    Alias Ids TPS48597,BAF39030.1, 367928 Molecular Weight 28292.36 Da.
    Residues 259 Isoelectric Point 4.83
    Sequence mnseqadildllsghtddttierlafeclltnmtddrvvslmnilgwqgdfncfaiggvpsaslastsl airkavrdlggehvvigtygtfllalacqmgavtpevtctavmpafsedeplylspvrsgvagashalr etmfslqaapalstpsrplradellperallgddyareelyrnvyqvlrgenpddptyltvstflkygs slentakelnvhpntvryrlkraaettgwdatdprdayvlttalaigrmrdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.202
    Matthews' coefficent 2.88 Rfactor 0.173
    Waters 785 Solvent Content 57.24

    Ligand Information
    Ligands SO4 (SULFATE) x 23;GOL (GLYCEROL) x 12
    Metals

    Jmol

     
    Google Scholar output for 3onq
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch