.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oon

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of an outer membrance protein from Borrelia burgdorferi B31. To be Published
    Site MCSG
    PDB Id 3oon Target Id APC62501.3
    Molecular Characteristics
    Source Borrelia burgdorferi b31
    Alias Ids TPS48626,AAC66563.1, 3.30.1330.60, 224326 Molecular Weight 14207.86 Da.
    Residues 121 Isoelectric Point 9.52
    Sequence aieveknnkginlsfdiefypnsfqilqkeykkidliakllekfkknnilieghteqfgleeemhelse kraraignylikmkvkdkdqilfkgwgsqkpkypkssplkaknrrveitiln
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.23614
    Matthews' coefficent 2.24 Rfactor 0.21234
    Waters Solvent Content 45.08

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch