.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oov

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287. To be Published
    Site MCSG
    PDB Id 3oov Target Id APC87691.2
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS48678,AAR35082.1, 3.30.450.40, 243231 Molecular Weight 18249.86 Da.
    Residues 166 Isoelectric Point 6.13
    Sequence fhqissriqksidvdevlrlcaeglhdvlgyervnilmadtartslsfvaavgtadfnpagvvlpldqr ggvitkcftdrqvymiddvsayptdfrlqspydairalrsksfvicpivvkgeaigvfavdnrssrrsl ndtdvdtiklfadqassaivrinllkai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.30485
    Matthews' coefficent 2.54 Rfactor 0.23681
    Waters 145 Solvent Content 51.61

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch