.
The Open Protein Structure Annotation Network
PDB Keyword
.

3opc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of FlgN chaperone from Bordetella pertussis. To be Published
    Site MCSG
    PDB Id 3opc Target Id APC38087.1
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS48589,CAE41661.1, PF05130.2.HMM.2, 257313 Molecular Weight 15792.53 Da.
    Residues 151 Isoelectric Point 5.49
    Sequence mnsaalksclerenalvveflhaleaetealmdrraheslqaavqrketladdlaqlgaerdallsgag lasgpagtdaaaaahpelgplwqalqanaaqarehnqrngtliavnlrhtqesldalrqaagtgaaaty daqgrgkrgyssa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.25574
    Matthews' coefficent 2.29 Rfactor 0.21306
    Waters 84 Solvent Content 46.21

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch