.
The Open Protein Structure Annotation Network
PDB Keyword
.

3owc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3owc Target Id APC102184
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS80850,APC102184, 15597774 Molecular Weight 21031.03 Da.
    Residues 186 Isoelectric Point 8.84
    Sequence mptpgtgsvpelqlvpfqlghfpilqrwfatekelvqwagpalrhplsleqmhedlaesrrrpplrllw sacrddqvighcqllfdrrngvvrlarivlapsargqglglpmleallaeafadadiervelnvydwna aarhlyrragfreeglrrsatrvgrerwnvvlmgllrqewaaggagnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.21214
    Matthews' coefficent 2.89 Rfactor 0.17649
    Waters 235 Solvent Content 57.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch