.
The Open Protein Structure Annotation Network
PDB Keyword
.

4kua

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a GNAT superfamily acetyltransferase PA4794. To be Published
    Site MCSG
    PDB Id 4kua Target Id APC102304
    Related PDB Ids 3pgp 4klv 4klw 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS80852,APC102304, 15599988 Molecular Weight 17784.47 Da.
    Residues 160 Isoelectric Point 6.90
    Sequence mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgqvlgfanfyq wqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfnanaaglllytqlgyqprai aerhdpdgrrvaliqmdkplep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.18975
    Matthews' coefficent 2.42 Rfactor 0.15754
    Waters 224 Solvent Content 49.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch