The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC108865
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS80854,APC108865, 115251230 Molecular Weight 29937.66 Da.
    Residues 267 Isoelectric Point 5.22
    Sequence mkklkliimfalvsallvtgcssgnnknkeeqkvirvatsgtyypfafkdkdklkgfevdfwdefakrt nckvewvltdfsglfglleadkadavsaqltatperekkyafsdaynysgtniivreddtsiksiddlv gkkvgvgtgavaneilkekypndeikivnyssatlkgnyqdlemgrldavvaqdvealiaikeqklnlk mieppiqfgacsfalqknekgekwtkeinevieemykdgtltkisenwlgkditkepine
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch