.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC21372.1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Expressed
    Target Id APC21372.1
    Molecular Characteristics
    Source Ruminococcus gnavus atcc 29149
    Alias Ids TPS19948,QAPOT7P1WGYPJIT1O5ILQBVWYCW, 411470 Molecular Weight 16071.64 Da.
    Residues 137 Isoelectric Point 9.54
    Sequence EKQNEIQKKKARRHQLAMDYPEFISTFTLYLGAGMPARRAWFQIASVYRQQENTRYVYEEMVYTMREMQRGTPESE CYEHFGMRCGLPVYRKFAVMLSQNLRKGTKGLAELLQREAAGAFEERKAAARKLGEETSTR
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

     

    Ligand Summary

     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch