.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22867

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22867
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32293,NP_459019, 99287 TM0014 Molecular Weight 35548.03 Da.
    Residues 315 Isoelectric Point 8.91
    Sequence mgskganksfdynlikildavilsgnaamaakklgitpaavslalkrlqsyypeelfsrgkggliptaka vdihqnfsqvmklvddtflcnskkdeafqitllgsdivesyylsqlynsdifdrilinhfsvrnmsreh isellftaqgdllisaepllesgienqiidsfksfvcicsskhmlstlsqlslhhfyssrhalyqpgmg asviyhdselfkddlyytgrrivgyrsdslnglmsmiertslialiplklalfyknhrkydikfiqppp elalksvqvyaswnknsrnistinemvsmlqtlssfrr
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0014
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch