.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22895

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC22895
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26434,NP_459153, 99287 TM0148 Molecular Weight 36524.05 Da.
    Residues 316 Isoelectric Point 5.32
    Sequence manwpnpfieqradpfilrdgsdyyfiasvpeydrleirransleglraadpvvvwrkpesgpmsqliwa pemhringkwyiyfaathtqaldklgmfqhrmfalecadadpltgkwtekgqiktpfdtfaldattfyh qgkqwylwaqkapdiagnsniylaelenpwtikgepvrlskpeydwecrgfwvnegpavvvhgdklfis ysasatdenycmgllwinvnddprdpanwhksprpvfttsyenrqygpghnsftqtpegenvlvyharn yteiegdplydpnrhtrlkrvrwdengmpdfgvppadti
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0148

    Name: glutamine-fructose-6-phosphate transaminase
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : f6p + gln-L --> gam6p + glu-L
    Classification: EC:2.6.1.16
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0148
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch