.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22896

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22896
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26290,NP_459161, 99287 TM0156 Molecular Weight 29331.32 Da.
    Residues 263 Isoelectric Point 5.36
    Sequence mkkvmlsalllslpllgyaqerfpspeaaasafaaavagknetqltallgddwrqflppegadpeavarf nrdwreghrivqkdntahlnvgredwqlpvpmvketggwrfdmaaagneiltrtigrnelstlqamhay vdaqqdyylqnhrwahriissegqkdglywptkagdvpsplgpnfspaapdegyhgyhfriisdndghg aallawpmhygetgvmsfmvnqddriyqadlgketeskvqaitrfapdaqwqvae
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0156

    Name: alkaline phosphatase
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : dhap + h2o --> dha + pi
    Classification: EC:3.1.3.1
     
    Name: alkaline phosphatase (Dihydroneopterin)
    Metabolic Subsystem: Folate Metabolism
    Reaction: : ahdt + h2o --> dhnpt + h + pi
    Classification: EC:3.1.3.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0156
    generated 12/2008
    Transmembrane protein

    HMM_TM0156

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch