.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22923

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC22923
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26336,NP_459267, 99287 TM0270 Molecular Weight 30564.83 Da.
    Residues 274 Isoelectric Point 5.25
    Sequence mkktdtlpatlsaliqeysiaegiqmaeqqvrenpakalcrhslfqllcvagdwsralhqlqlcarmean ytqearlyrelvrcemfrhtvfqgeqrpgfllpqpvwvesllaalachddtgevdkhrntaleaitdtg gqwnggafdwasdsdsrlgpvlelvtggvyiwlpfsqirslespqptrltdllwkpvnitlvngdthga wlftrysgsesasdalrlcretawqdgpgettvralgqkvwltshgdislldmahctfhaqendga
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0270

    Name: "5,10-methylenetetrahydrofolate reductase (NADH) reversible"
    Metabolic Subsystem: Folate Metabolism
    Reaction: : h + mlthf + nadh <==> 5mthf + nad
    Classification: EC:1.5.1.20
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0270
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch