.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22927

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC22927
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26398,NP_459274, 99287 TM0276 Molecular Weight 17731.95 Da.
    Residues 161 Isoelectric Point 5.44
    Sequence maydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnldfdhyidraspnlf kycasgkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeiasretvelsfstvkqeyvvq nqqggsggtitagydfkankei
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0276

    Name: L-arabinose isomerase
    Metabolic Subsystem: Arabinose Metabolism
    Reaction: : arab-L <==> rbl-L
    Classification: EC:5.3.1.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0276
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch