.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22931

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22931
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26368,NP_459280, 99287 TM0282 Molecular Weight 47352.99 Da.
    Residues 434 Isoelectric Point 8.83
    Sequence mtdstltppaadmmsflsttpehkdseyetpvhtsqrtelnvivedgpdsklrlaeisaaanpllaaarp llcalaampakldaalvepyrnllvremhlyqtlcdqanlrrehvlavryclctaldeaannttwgrrg vwagksllvtfhgeseggiklfqiigrlaasfqehgnvleviyhllglgfegrysvqpdgrkqldnirq qlltqlsqrrdpvmpalspdfqgaisgrlrrmrrvpvwlsagiallamltlfglyshrmdvqtvtvqqh idaigiklppppvpvhklrlkillaneiarglltvdeddqhsrvvfrgdamfvpgqktvsdairpvink aareiarvggavtvtghtdsqpihsaefpsnlvlsekraaevaalltsggvpagrvhivgkgdtvpvad ngskagraknrrveilvve
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0282

    Name: aldose 1-epimerase (galactose)
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : gal-bD --> gal
    Classification: EC:5.1.3.3
     
    Name: aldose 1-epimerase (glucose)
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : glc-bD --> glc-D
    Classification: EC:5.1.3.3
     
    Name: aldose 1-epimerase
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : Glc-aD <==> glc-bD
    Classification: EC:5.1.3.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0282
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch