The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22935
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26150,NP_459290, 99287 TM0292 Molecular Weight 26992.28 Da.
    Residues 246 Isoelectric Point 5.53
    Sequence mqqqgwrtylydaeqpytpvasvtgkgesrqvwyyhtdvtgtpqevtaadgtlvwagyikgfgenaadis nsgayfhqplrlpgqyfddetglhynlfryyapecgrfvsqdpiglagglnlyqyapnpirwidplgla ilehqsnfdaarrtgfenagmtnpedvtfskvdpktgtvvefkgpngakvaydaphadmdvtaghdkph vgwqsagkrgsgganrgnitydgpqhphrsdskgddkc
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0292

    Name: aconitase
    Other genes that carryout this rxn:TM0291
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : cit <==> icit
    Classification: EC:

    Ligand Information
    Model TM0292
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch