The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22945
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26334,NP_459344, 99287 TM0349 Molecular Weight 12633.56 Da.
    Residues 119 Isoelectric Point 9.39
    Sequence mkkilvcfvglaltacsanslnygaeqvrvmtsepgkecsylgditgsqgnfftggwtsnsnletgarnd lknkaykmggntvvlltqragqtgsswhgsgsskqtnvtlsgnvyrcpr
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0349

    Name: 3-dehydroquinate dehydratase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : 3dhq <==> 3dhsk + h2o
    Classification: EC:

    Ligand Information
    Model TM0349
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch