.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22959

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22959
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26414,NP_459407, 99287 TM0412 Molecular Weight 12037.51 Da.
    Residues 108 Isoelectric Point 11.94
    Sequence mrrrvaptshyfrrchqpknrpvaiptsvgaarscqivmlnsvsvilppllqwqrfaailnlsgvklapv mlpvnteqcagvfsfqrqghrgssprniaphrvapayr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0412

    Name: aldose reductase (methylglyoxal)
    Metabolic Subsystem: Others
    Reaction: : h + mthgxl + nadph --> acetol + nadp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0412
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch