.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22962.2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC22962.2
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32166,NP_459420.1, 3.40.250.10, 99287 TM0425 Molecular Weight 12779.83 Da.
    Residues 112 Isoelectric Point 4.45
    Sequence fsildkvveeannvdireiaqqtqqevvevetvsgfgpndvildirsvdeqddkplkvegvdvvslpfyk lstkfgdldqsktwllwcergvmsrlqalylreqgfanvkvy
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0425
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch