.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC22964

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22964
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26372,NP_459434, 99287 TM0438 Molecular Weight 48927.02 Da.
    Residues 427 Isoelectric Point 6.42
    Sequence mdipqaikyyeqacdldgdygcfnaayfyeygigtqkditqaktlakqlrekinlsninldkkvseriig svysnkleayrdlsfrphfiqglsfyfyapqsderkllsrigfdsshlariailwaregdpevayqtak lvstlyfnnetktidiaealkwlrisaekgdadsqtllgflyehaglglqpdgekarkwyemaaqqgng ealytlgrmyysgvlvnvdydkalyffkkayekklqeaadylaqmyfngqsvdvdcqqswhyydnsyik kmtqrdyldycekdrkrrndfnqqlpeltlekyaglfgridniplcqigfvvntnklihvanlrvelil kndagvsdermvafpplglntlgaeqgmgdsfksmgyllmkngdlcdyhkltftvksatatingkkvdl lktdnlhiiqnr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0438

    Name: phosphogluconate dehydrogenase
    Metabolic Subsystem: Pentose Phosphate Pathway
    Reaction: : 6pgc + nadp --> co2 + nadph + ru5p-D
    Classification: EC:1.1.1.44
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0438
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch