The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22967
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32318,NP_459474, 99287 TM0479 Molecular Weight 35255.76 Da.
    Residues 311 Isoelectric Point 5.90
    Sequence merlpttphdavfrqmlmqkevardflaihmpedflaicdldslklesgsfvednlrsrysdilyslhtq hgpgyvyaliehqsksdrlmafrlmryaiaamqrhldaghdtlplvvpilfyhgpespwpyslnwhnmf vkpdmakalysrdfalvdlttmpdnqllqhrriamlellqkhirqrdlselldplitlltqdhltdaql svlinymlkagnaaepgalirqlaqgapqykeqlmtiaewleekgrteglqkglqkgleqglaqgreae araiarkmlanglepgliasvtgitpeelstlsh
      BLAST   FFAS

    Ligand Information
    Model TM0479
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch