.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23024

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23024
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26410,NP_459705, 99287 TM0720 Molecular Weight 34698.68 Da.
    Residues 298 Isoelectric Point 9.51
    Sequence mmkctalivtfnrleklkksvretvkagfssivivnngssdgtrewlsslsepgitilnlkdnlggaggf kvgsqyicsysnadwvffydddaypeinilkhfslldtsryrifasrvqdtygrscrmnlpfirvpstv fetiyyamrperfspvrtqvtdvqtvsfvgmiidrkvlnnhlndihdelflyyddfffgyklvlsgqki ryspeikfihdisihgkcicpewkvyylcrnllllrkllpvprifsvlsivlrlskylailpwqrkkfr ylyfiwqgilhglkgisgkyh
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0720

    Name: "glycine hydroxymethyltransferase, reversible"
    Metabolic Subsystem: Glycine and Serine Metabolism
    Reaction: : ser-L + thf <==> gly + h2o + mlthf
    Classification: EC:2.1.2.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0720
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch