.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23044

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC23044
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26220,NP_459871, 99287 TM0895 Molecular Weight 11136.03 Da.
    Residues 102 Isoelectric Point 5.33
    Sequence mnvlkqqitasiakdiafrlgaelndeeadifadgynaamlqncnvvtsgkpltitlpdtsskafwsstg knetfhpetykrqvkeaierscviagigvevk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0895

    Name: glycogen synthase (ADPGlc)
    Metabolic Subsystem: Glycogene synthesis
    Reaction: : adpglc --> adp + glycogen + h
    Classification: EC:2.4.1.21
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0895
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch