.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23045

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23045
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26248,NP_459872, 99287 TM0896 Molecular Weight 14939.95 Da.
    Residues 130 Isoelectric Point 6.62
    Sequence mgspvgrndeaetvlrevemamktelatvaardlqiieyrgqrvvtteqlaagygtdaenirrnfnrnks rfiegkhyfqitgpelenlrvtfspaqisnktritgtysnaefqsrvsnwltdffriwse
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0896

    Name: galactose-1-phosphate uridylyltransferase
    Other genes that carryout this rxn:TM1191 TM1191
    Metabolic Subsystem: Galactose metabolism
    Reaction: : gal1p + h + utp <==> ppi + udpgal
    Classification: EC:2.7.7.10
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0896
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch