The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC23257
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32523,NP_459927, 99287 TM0951 Molecular Weight 31377.91 Da.
    Residues 286 Isoelectric Point 5.99
    Sequence mkqitgvytaprphwvgdgfpvrslfsyqshaqqlspfllldyagphtftpgnekrgvgehphrgfetvt ivysgevehrdstgrggvigpgdvqwmtagagilheefhsdaftrrggelemvqlwvnlpmkdkmttpg yqsithdviptvtlpdnagvvrviagryeetkgpahtfsplnvwdmrlqrnrqltlaqpegwstalvvl kgnitvngttpvneaqlvvlsqqgktlhleassdasvlllsgeplnepivgygpfvmntkqeiaeavrd fnsgrfgqi
      BLAST   FFAS

    Ligand Information
    Model TM0951
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch