The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC23275
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32833,NP_459991, 99287 TM1016 Molecular Weight 12912.34 Da.
    Residues 115 Isoelectric Point 10.32
    Sequence marpktqsermiileriiglvkeqgrittndvvaifgvhrttaekylrialerggfirhgrcgifrdqra vidydlrrysssqvtgfsalpvlekspvmqvygaskmsinkggaq
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch